PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 333aa    MW: 37533.1 Da    PI: 6.5924
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606135.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +++ +v+ +G g+W++++++ g++R++k+c++rw +yl
   XP_009606135.1 14 RGPWTAEEDAKILAYVASHGIGNWTLVPQKAGLNRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.54.7e-1668110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+e +++++k  G++ W++Ia+ ++ gRt++++k++w++
   XP_009606135.1  68 DNFTPQEEECIIELHKTIGSR-WSLIAKQLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.02965IPR017930Myb domain
SuperFamilySSF466892.02E-3111108IPR009057Homeodomain-like
SMARTSM007179.1E-151363IPR001005SANT/Myb domain
PfamPF002494.6E-161461IPR001005SANT/Myb domain
CDDcd001673.11E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.22866116IPR017930Myb domain
SMARTSM007176.2E-1566114IPR001005SANT/Myb domain
CDDcd001675.22E-1169112No hitNo description
PfamPF002491.1E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKA NVKRGPWTAE EDAKILAYVA SHGIGNWTLV PQKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEECIIE LHKTIGSRWS LIAKQLPGRT DNDVKNYWNT KLKKKLVNMG  120
IDPVTHKPFA QVFAEYGKIS GLPIQNARNH ICLPNNTTEI SKQRPFSLRE NYSTQKYTWD  180
PKAQYQVIHE ETLQTHSFSE VSPLISSATS FNPTVFSSSS SYASVQSQVH TTASSSSTST  240
WNEFVFGDLC TSTDTEQKQE YQLQAGIYLS KDLSNSVHKD NPTCGEVTEV EENQSVVEAT  300
CSSAVDSFVD TILARDKQML MDFPPLLDVY LDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2469624e-64AC246962.1 Solanum lycopersicum chromosome 3 clone FOS0173E02, complete sequence.
GenBankAC2470254e-64AC247025.1 Solanum lycopersicum chromosome 3 clone FOS0173E02, complete sequence.
GenBankHG9755154e-64HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606135.10.0PREDICTED: myb-related protein 315
TrEMBLM1AG011e-144M1AG01_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000220091e-143(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-82MYB family protein